PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Spipo11G0051800
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Araceae; Lemnoideae; Spirodela
Family Dof
Protein Properties Length: 218aa    MW: 23410.4 Da    PI: 8.0493
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Spipo11G0051800genomeMIPS/IBISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof109.51.7e-34864359
           zf-Dof  3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknk 59
                     +++lkcprCdstntkfCyynnys sqPr+fCkaC+r+Wt+GG+lrnvPvGg r+  +
  Spipo11G0051800  8 KAELKCPRCDSTNTKFCYYNNYSRSQPRHFCKACKRHWTAGGTLRNVPVGGCRKAGR 64
                     6789*********************************************98665544 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074783.0E-21764IPR003851Zinc finger, Dof-type
PfamPF027011.1E-301062IPR003851Zinc finger, Dof-type
PROSITE profilePS5088426.9721165IPR003851Zinc finger, Dof-type
PROSITE patternPS0136101349IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 218 aa     Download sequence    Send to blast
MADPLRQKAE LKCPRCDSTN TKFCYYNNYS RSQPRHFCKA CKRHWTAGGT LRNVPVGGCR  60
KAGRRPRTPH QPSSGKQTIK LPLSFPQEIF YPQPDFPDCG YMGSLPLHHG GIPATETETG  120
GGGCSFPVFL NLLGPEDLPP PPPAAAPWDL LQPTQPSFST VTTASSCQTA AESSSPPSSS  180
GCWDDLTGFL FSPLLEHPPP PPPPGLCQSK YSSSPAE*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9661217e-34EU966121.1 Zea mays clone 291888 hypothetical protein mRNA, complete cds.
GenBankKJ7276867e-34KJ727686.1 Zea mays clone pUT5625 C2C2-DOF transcription factor (DOF34) mRNA, partial cds.
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP14037367
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66940.14e-30Dof family protein